Proteintech, 11841-1-AP, CD207 Polyclonal antibody

Size: 20ul / 150ul The CD207 (11841-1-AP) by Proteintech is a Polyclonal antibody targeting CD207 in WB, IHC, ELISA applications with reactivity to human, mouse samples 11841-1-AP targets CD207 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human skin tissue, mouse skin tissue Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:3000-1:8000 Background Information CD207 protein (also known as langerin protein) is encoded by the CD207 gene and is a type of C-type lectin receptor that is specifically expressed on the surface of LCs. It is one of the specific immunohistochemical markers of LCs (PMID: 37383183, PMID: 28109175). CD207 plays an important role in a series of non-classical antigen processing processes, such as forming Birbeck granules and processing and transporting them to local lymphoid tissue, and inducing LC maturation (PMID: 32326440). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2479 Product name: Recombinant human CD207 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-328 aa of BC022278 Sequence: MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQAVLYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP Predict reactive species Full Name: CD207 molecule, langerin Calculated Molecular Weight: 328 aa, 37 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC022278 Gene Symbol: CD207 Gene ID (NCBI): 50489 RRID: AB_2074314 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UJ71 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.