Iright
BRAND / VENDOR: Proteintech

Proteintech, 11844-1-AP, UBE2E2 Polyclonal antibody

CATALOG NUMBER: 11844-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The UBE2E2 (11844-1-AP) by Proteintech is a Polyclonal antibody targeting UBE2E2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11844-1-AP targets UBE2E2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human thyroid gland tissue, human brain tissue, mouse embryo tissue Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information UBE2E2(ubiquitin-conjugating enzyme E2 E2) is also named as UBCH8 and belongs to the ubiquitin-conjugating enzyme family. This gene encodes a 22 kDa protein that functions as a major ISG15 E2 enzyme raises the possibility that ISG15 conjugation might use UbcH8-competent Ub E3 enzymes and also function as an E2 for several Ub E3 enzymes, including both HECT E3s and RING E3s(PMID: 15131269). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2509 Product name: Recombinant human UBE2E2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC022332 Sequence: MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT Predict reactive species Full Name: ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast) Calculated Molecular Weight: 201 aa, 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC022332 Gene Symbol: UBE2E2 Gene ID (NCBI): 7325 RRID: AB_2210274 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96LR5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924