Proteintech, 11847-1-AP, SPCS1 Polyclonal antibody

Size: 20ul / 150ul The SPCS1 (11847-1-AP) by Proteintech is a Polyclonal antibody targeting SPCS1 in WB, IF/ICC, ELISA applications with reactivity to human samples 11847-1-AP targets SPCS1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, human skin tissue, PC-3 cells Positive IF/ICC detected in: BxPC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2407 Product name: Recombinant human SPCS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC000884 Sequence: MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLAQLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAK Predict reactive species Full Name: signal peptidase complex subunit 1 homolog (S. cerevisiae) Calculated Molecular Weight: 102 aa, 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC000884 Gene Symbol: SPCS1 Gene ID (NCBI): 28972 RRID: AB_2195400 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6A9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.