Iright
BRAND / VENDOR: Proteintech

Proteintech, 11860-1-AP, DLEU1 Polyclonal antibody

CATALOG NUMBER: 11860-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DLEU1 (11860-1-AP) by Proteintech is a Polyclonal antibody targeting DLEU1 in WB, IHC, ELISA applications with reactivity to human samples 11860-1-AP targets DLEU1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, A549 cells Positive IHC detected in: human colon cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2435 Product name: Recombinant human DLEU1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-78 aa of BC020692 Sequence: MRPCIWIHVHLKPPCRLVELLPFSSALQGLSHLSLGTTLPVILPERNEEQNLQELSHNADKYQMGDCCKEEIDDSIFY Predict reactive species Full Name: deleted in lymphocytic leukemia 1 (non-protein coding) Calculated Molecular Weight: 78 aa, 9 kDa Observed Molecular Weight: 27-30 kDa GenBank Accession Number: BC020692 Gene Symbol: DLEU1 Gene ID (NCBI): 10301 RRID: AB_874117 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43261 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924