Proteintech, 11867-1-AP, Ficolin 3 Polyclonal antibody

Size: 20ul / 150ul The Ficolin 3 (11867-1-AP) by Proteintech is a Polyclonal antibody targeting Ficolin 3 in WB, IF/ICC, ELISA applications with reactivity to human samples 11867-1-AP targets Ficolin 3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Ficolins are a group of oligomeric lectins with subunits consisting of both collagen-like and fibrinogen-like domains (PMID: 20375620). They are innate pattern recognition receptors and play integral roles within the innate immune response. In humans, there are three ficolins termed M-, L-, and H-ficolin (also referred to as ficolin-1, -2, and -3) whereas rodents only possess ficolin-A and -B, which are the orthologues of human L- and M-ficolin, respectively (PMID: 30868077). Ficolin-3 (Hakata antigen or H-ficolin) was initially identified based on its reactivity with sera from patients with systemic lupus erythematosus (PMID: 1859827). It has been shown to have a calcium-independent lectin activity. Ficolin-3 is associated with MASPs and sMAP, and which activates the lectin pathway (PMID: 11907111). Ficolin-3 shows affinity for GalNAc, GlcNAc, D-fucose and galactose (PMID: 30868077). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2449 Product name: Recombinant human FCN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-288 aa of BC020731 Sequence: CLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR Predict reactive species Full Name: ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen) Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC020731 Gene Symbol: Ficolin-3 Gene ID (NCBI): 8547 RRID: AB_2104432 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75636 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.