Proteintech, 11874-1-AP, HNMT Polyclonal antibody

Size: 20ul / 150ul The HNMT (11874-1-AP) by Proteintech is a Polyclonal antibody targeting HNMT in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11874-1-AP targets HNMT in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-29 cells, human liver tissue, mouse liver tissue, HepG2 cells Positive IHC detected in: human liver cancer tissue, human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information HNMT, a histamine-metabolizing enzyme, inactivates histamine by N-methylation. It plays an important role in degrading histamine and in regulating the airway response to histamine. HNMT in human astrocytes play a role in the regulation of extraneuronal histamine concentration and the activities of histaminergic neurons. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2462 Product name: Recombinant human HNMT protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-292 aa of BC020677 Sequence: MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGDENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA Predict reactive species Full Name: histamine N-methyltransferase Calculated Molecular Weight: 292 aa, 33 kDa Observed Molecular Weight: 30-33 kDa GenBank Accession Number: BC020677 Gene Symbol: HNMT Gene ID (NCBI): 3176 RRID: AB_2117048 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P50135 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.