Product Description
Size: 20ul / 150ul
The RBBP6 (11882-1-AP) by Proteintech is a Polyclonal antibody targeting RBBP6 in WB, IHC, ELISA applications with reactivity to human, mouse samples
11882-1-AP targets RBBP6 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: Jurkat cells, HEK-293 cells, MCF-7 cells
Positive IHC detected in: human placenta tissue, human rectal cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Immunohistochemistry (IHC): IHC : 1:250-1:1000
Background Information
RBBP6 (retinoblastoma binding protein 6) is a multifunctional protein that interacts with both p53 and pRb and has been implicated in mRNA processing. It has also been identified as a putative E3 ubiquitin ligase due to the presence of a RING finger domain [PMID:18851979]. RBBP6 contains an N-terminal ubiquitin-like domain and a cysteine-rich RING finger-like domain, through which it promotes the ubiquitination of p53 by Hdm2 in an E4-like manner [PMID:17470788]. It is implicated in a diverse set of cellular functions, including mRNA metabolism, regulation of the cell cycle, tumorigenesis, and development [PMID:12938151,17470788].
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag2484 Product name: Recombinant human RBBP6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC029352 Sequence: MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPAMATTKAVCKNTISHFFYTLLLPL Predict reactive species
Full Name: retinoblastoma binding protein 6
Calculated Molecular Weight: 1792 aa, 200 kDa
Observed Molecular Weight: 250 kDa
GenBank Accession Number: BC029352
Gene Symbol: RBBP6
Gene ID (NCBI): 5930
RRID: AB_2177794
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q7Z6E9
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924