Iright
BRAND / VENDOR: Proteintech

Proteintech, 11887-1-AP, PSMA3 Polyclonal antibody

CATALOG NUMBER: 11887-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PSMA3 (11887-1-AP) by Proteintech is a Polyclonal antibody targeting PSMA3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, monkey samples 11887-1-AP targets PSMA3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, monkey samples. Tested Applications Positive WB detected in: A549 cells, PC-12 cells, human lung tissue, COS-7 cells, RAW 264.7 cells, mouse spleen tissue, rat brain tissue, HeLa cells, NIH/3T3 cells, mouse liver tissue Positive IHC detected in: human lymphoma tissue, human liver cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:200-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PSMA3(Proteasome subunit alpha type-3) is also named as HC8, PSC8 and belongs to the peptidase T1A family. The proteasome is a multicatalytic protease complex that catalyzes an energy-dependent, extralysosomal proteolytic pathway responsible for selective elimination of proteins with aberrant structures and naturally occurring short-lived proteins related to metabolic regulation and cell cycle progression. It has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat, monkey Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2495 Product name: Recombinant human PSMA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-255 aa of BC029402 Sequence: MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADMAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM Predict reactive species Full Name: proteasome (prosome, macropain) subunit, alpha type, 3 Calculated Molecular Weight: 255 aa, 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC029402 Gene Symbol: PSMA3 Gene ID (NCBI): 5684 RRID: AB_2171420 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P25788 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924