Iright
BRAND / VENDOR: Proteintech

Proteintech, 11895-1-AP, PHF19 Polyclonal antibody

CATALOG NUMBER: 11895-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PHF19 (11895-1-AP) by Proteintech is a Polyclonal antibody targeting PHF19 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11895-1-AP targets PHF19 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue Positive IF/ICC detected in: Mouse ES cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information PHD FINGER PROTEIN 19(PHF19), a protein homologous to the Drosophila 'Polycomblike' (Pcl) protein, encoded by human gene PCL, which encodes 2 deduced proteins: a short form of 207 aa and a long form of 580 aa. The PCL family proteins contains a PCL homology domain, a Tudor domain, 2 PHD fingers and a C-terminal tail. Both of these forms can inhibit transcriptional activity. And the long form is corelated with cancer. The mRNA level of PHF19 is low in many normal tissue, it's elevated in cancer-derived cell lines. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2511 Product name: Recombinant human PHF19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-207 aa of BC022374 Sequence: MENRALDPGTRDSYGATSHLPNKGALAKVKNNFKDLMSKLTEGQYVLCRWTDGLYYLGKIKRVSSSKQSCLVTFEDNSKYWVLWKDIQHAGVPGEEPKCNICLGKTSGPLNEILICGKCGLGYHQQCHIPIAGSADQPLLTPWFCRRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSKQKGHTWALETDSASATVLGQDL Predict reactive species Full Name: PHD finger protein 19 Calculated Molecular Weight: 580 aa, 63 kDa Observed Molecular Weight: 22 kDa, 66 kDa GenBank Accession Number: BC022374 Gene Symbol: PHF19 Gene ID (NCBI): 26147 RRID: AB_10804890 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5T6S3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924