Proteintech, 11905-1-AP, RNF7 Polyclonal antibody

Size: 20ul / 150ul The RNF7 (11905-1-AP) by Proteintech is a Polyclonal antibody targeting RNF7 in WB, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 11905-1-AP targets RNF7 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human liver tissue, human heart tissue, human skeletal muscle tissue, human testis tissue Positive IP detected in: mouse heart tissue Positive IF-P detected in: mouse heart tissue Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information RNF (ring finger protein 7 ) is a novel zinc RING finger protein which is redox responsive and protects mammalian cells from apoptosis.It is shown to be localised in the cytoplasmand nucleus of the cell and is expressed in the heart, liver, skeletal muscle predominantly. RNF7 forms oligomers(55 kDa),dimer(28 kDa) and monomer(13 kDa) in the presence of different concentrations of the reductant. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2553 Product name: Recombinant human SAG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC008627 Sequence: MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK Predict reactive species Full Name: ring finger protein 7 Calculated Molecular Weight: 113 aa, 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC008627 Gene Symbol: RNF7 Gene ID (NCBI): 9616 RRID: AB_10697836 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBF6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.