Iright
BRAND / VENDOR: Proteintech

Proteintech, 11915-1-AP, VPREB3 Polyclonal antibody

CATALOG NUMBER: 11915-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The VPREB3 (11915-1-AP) by Proteintech is a Polyclonal antibody targeting VPREB3 in WB, ELISA applications with reactivity to human samples 11915-1-AP targets VPREB3 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Ramos cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information VPREB3 (formerly named 8HS20) is a protein that associates with mu chains in the endoplasmic reticulum of pre-B cell lines (PMID: 8491176; 22684248). VPREB3 is normally expressed by precursor B cells in bone marrow and by a subset of normal germinal center B cells in secondary lymphoid organs. It has been reported that VPREB3 expression is associated with B-cell tumors with c-MYC abnormalities (PMID: 20823132). Specification Tested Reactivity: human Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2528 Product name: Recombinant human VPREB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-123 aa of BC020666 Sequence: MACRCLSFLLMGTFLSVSQTVLAQLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP Predict reactive species Full Name: pre-B lymphocyte 3 Calculated Molecular Weight: 123 aa, 14 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC020666 Gene Symbol: VPREB3 Gene ID (NCBI): 29802 RRID: AB_2216942 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UKI3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924