Iright
BRAND / VENDOR: Proteintech

Proteintech, 11932-1-AP, PRAP1 Polyclonal antibody

CATALOG NUMBER: 11932-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PRAP1 (11932-1-AP) by Proteintech is a Polyclonal antibody targeting PRAP1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 11932-1-AP targets PRAP1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: L02 cells, mouse pancreas tissue Positive IHC detected in: human liver tissue, human kidney tissue, mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Proline rich acidic protein 1 (PRAP1) is also named as PRO1195 or UPA. It may play an important role in maintaining normal growth homeostasis in epithelial cells. Mitotic arrest deficient 1 (MAD1) is a key component in mitotic checkpoint signalling. Recent study identified PRAP1 as a novel MAD1 binding partner using yeast-two hybrid screening (PMID: 24374861). PRAP1 has four isoforms with MW 16-20 kDa and 10 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2526 Product name: Recombinant human PRAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC029447 Sequence: RLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPENRAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ Predict reactive species Full Name: proline-rich acidic protein 1 Calculated Molecular Weight: 151 aa, 17 kDa Observed Molecular Weight: 16-20 kDa GenBank Accession Number: BC029447 Gene Symbol: PRAP1 Gene ID (NCBI): 118471 RRID: AB_10951856 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96NZ9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924