Proteintech, 11940-1-AP, ARHGAP15 Polyclonal antibody

Size: 20ul / 150ul The ARHGAP15 (11940-1-AP) by Proteintech is a Polyclonal antibody targeting ARHGAP15 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 11940-1-AP targets ARHGAP15 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells, Jurkat cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ARHGAP15 (Rho GTPase Activating Protein 15) is a Rac1-specific GAP. Diseases associated with ARHGAP15 include Diverticulitis and Meier-Gorlin Syndrome 2. Among its related pathways are Signaling by Rho GTPases and RAC2 GTPase cycle. ARHGAP15 deregulation is implicated in many abnormalities (PMID: 29867200). ARHGAP15 decreased in glioma, which promoted the aggressive phenotypes of glioma cells through the activation of Rac19. Intronic mutation of ARHGAP15 is associated with diverticular disease. In addition, ARHGAP15 was a prognosis-related biomarker for pancreatic ductal adenocarcinoma (PMID: 28979141). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2538 Product name: Recombinant human ARHGAP15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 176-475 aa of BC016701 Sequence: IILDWFHAIKNAIDRLPKDSSCPSRNLELFKIQRSSSTELLSHYDSDIKEQKPEHRKSLMFRLHHSASDTSDKNRVKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQCIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHVVTGALKMFFRELPEPLFPYSFFEQFVEAIKKQDNNTRIEAVKSLVQKLPPPNRDTMKVPFGHLTKIVAKASKNLMSTQSLGIVFGPTLLRAENETGNMAIHMVYQNQIAELMLSEYSKIFGSEED Predict reactive species Full Name: Rho GTPase activating protein 15 Calculated Molecular Weight: 475 aa, 55 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC016701 Gene Symbol: ARHGAP15 Gene ID (NCBI): 55843 RRID: AB_874081 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q53QZ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.