Iright
BRAND / VENDOR: Proteintech

Proteintech, 11957-1-AP, SPANXC Polyclonal antibody

CATALOG NUMBER: 11957-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SPANXC (11957-1-AP) by Proteintech is a Polyclonal antibody targeting SPANXC in WB, ELISA applications with reactivity to human samples 11957-1-AP targets SPANXC in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2561 Product name: Recombinant human SPANXC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-97 aa of BC054023 Sequence: MDKQSSAGGVKRSVPCESNEVNETMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNVKRTSPEELLNDHARENRINPLQMEEEEFMEIMVEIPAK Predict reactive species Full Name: SPANX family, member C Calculated Molecular Weight: 97 aa, 11 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC054023 Gene Symbol: SPANXC Gene ID (NCBI): 64663 RRID: AB_10664922 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NY87 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924