Iright
BRAND / VENDOR: Proteintech

Proteintech, 11974-1-AP, FICD Polyclonal antibody

CATALOG NUMBER: 11974-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FICD (11974-1-AP) by Proteintech is a Polyclonal antibody targeting FICD in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 11974-1-AP targets FICD in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, Jurkat cells Positive IHC detected in: human small intestine tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Adenosine monophosphate-protein transferase FICD, also named as HIP13 or HYPE, is a 458 amino acid protein, which contains one fido domain and two TPR repeats. FICD localizes in the membrane and belongs to the fic family. FICD as an adenylyltransferase that mediates the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins. The fido domain mediates the adenylyltransferase activity Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2597 Product name: Recombinant human FICD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 159-458 aa of BC001342 Sequence: ADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSIPKGNSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP Predict reactive species Full Name: FIC domain containing Calculated Molecular Weight: 458 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC001342 Gene Symbol: FICD Gene ID (NCBI): 11153 RRID: AB_2877811 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BVA6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924