Iright
BRAND / VENDOR: Proteintech

Proteintech, 11985-1-AP, DCD Polyclonal antibody

CATALOG NUMBER: 11985-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DCD (11985-1-AP) by Proteintech is a Polyclonal antibody targeting DCD in IHC, ELISA applications with reactivity to human samples 11985-1-AP targets DCD in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human skin tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Dermcidin, also named as DCD, AIDD and DSEP, is human antibiotic peptide secreted by sweat glands. It displays antimicrobial activity thereby limiting skin infection by potential pathogens in the first few hours after bacterial colonization. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2613 Product name: Recombinant human DCD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC062682 Sequence: MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL Predict reactive species Full Name: dermcidin Calculated Molecular Weight: 11 kDa GenBank Accession Number: BC062682 Gene Symbol: DCD Gene ID (NCBI): 117159 RRID: AB_2877812 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P81605 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924