Product Description
Size: 20ul / 150ul
The GNGT2 (11988-1-AP) by Proteintech is a Polyclonal antibody targeting GNGT2 in WB, IHC, ELISA applications with reactivity to human, mouse samples
11988-1-AP targets GNGT2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: mouse retina tissue
Positive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
GNGT2, also known as GNG8, GNG9 and GNGT8, belongs to the G protein gamma family. Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. This antibody has weak cross-reactivity of GNGT1 protein, as the immunogen of GNGT2 shares about 65% homology with GNGT1.
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag2618 Product name: Recombinant human GNGT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-69 aa of BC008663 Sequence: MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS Predict reactive species
Full Name: guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2
Calculated Molecular Weight: 69 aa, 8 kDa
Observed Molecular Weight: 8 kDa
GenBank Accession Number: BC008663
Gene Symbol: GNGT2
Gene ID (NCBI): 2793
RRID: AB_2877813
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O14610
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924