Iright
BRAND / VENDOR: Proteintech

Proteintech, 12051-1-AP, APBB3 Polyclonal antibody

CATALOG NUMBER: 12051-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The APBB3 (12051-1-AP) by Proteintech is a Polyclonal antibody targeting APBB3 in WB, ELISA applications with reactivity to human samples 12051-1-AP targets APBB3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information APBB3 is a member of the APBB protein family. It is found in the cytoplasm and binds to the intracellular domain of the Alzheimer's disease beta-amyloid precursor protein (APP) as well as to other APP-like proteins. It is thought that the protein encoded by this gene may modulate the internalization of APP. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2681 Product name: Recombinant human APBB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 187-486 aa of BC013158 Sequence: HSLIHCQPLVHIRVWGVGSSKGRDRDFAFVASDKDSCMLKCHVFRCDVPAKAIASALHGLCAQILSERVEVSGDASCCSPDPISPEDLPRQVELLDAVSQAAQKYEALYMGTLPVTKAMGMDVLNEAIGTLTARGDRNAWVPTMLSVSDSLMTAHPIQAEASTEEEPLWQCPVRLVTFIGVGRDPHTFGLIADLGRQSFQCAAFWCQPHAGGLSEAVQAACMVQYQKCLVASAARGKAWGAQARARLRLKRTSSMDSPGGPLPLPLLKGGVGGAGATPRKRGVFSLLDAFRLKPSLLHMP Predict reactive species Full Name: amyloid beta (A4) precursor protein-binding, family B, member 3 Calculated Molecular Weight: 486 aa, 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC013158 Gene Symbol: APBB3 Gene ID (NCBI): 10307 RRID: AB_3085387 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95704 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924