Proteintech, 12059-1-AP, PSMD14/POH1 Polyclonal antibody

Size: 20ul / 150ul The PSMD14/POH1 (12059-1-AP) by Proteintech is a Polyclonal antibody targeting PSMD14/POH1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12059-1-AP targets PSMD14/POH1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, BT-549 cells, K-562 cells, rat heart tissue, HeLa cells, MCF-7 cells, MCF-10A cells, MDA-MB-231 cells, MDA-MB-468 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A375 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The PSMD14 (POH1, also known as Rpn11/MPR1/S13/CepP1) protein is a metalloprotease component of the 26S proteasome that specifically cleaves 'Lys-63'-linked polyubiquitin chains. The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins. PSMD14 is highly expressed in the heart and skeletal muscle. In carcinoma cell lines. down-regulation of PSMD14 by siRNA transfection had a considerable impact on cell viability causing cell arrest in the G0-G1 phase, ultimately leading to senescence. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2694 Product name: Recombinant human PSMD14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC009524 Sequence: MLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK Predict reactive species Full Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC009524 Gene Symbol: PSMD14 Gene ID (NCBI): 10213 RRID: AB_2170454 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00487 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.