Iright
BRAND / VENDOR: Proteintech

Proteintech, 12069-1-AP, NBL1 Polyclonal antibody

CATALOG NUMBER: 12069-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NBL1 (12069-1-AP) by Proteintech is a Polyclonal antibody targeting NBL1 in WB, ELISA applications with reactivity to human, mouse, rat samples 12069-1-AP targets NBL1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse colon tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information NBL1 (neuroblastoma suppression of tumorigenicity 1), also named as DAN, is the founding member of the DAN subfamily. It was originally identified as a putative tumor suppressor gene in a transformed fibroblast rat model (PMID: 9516839), whereby it was significantly down-regulated in v-src-transformed rat fibroblasts. The MW of this protein is 19 kDa, and this antibody specially recognises the 19 kDa protein. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2706 Product name: Recombinant human NBL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-180 aa of BC012037 Sequence: LALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED Predict reactive species Full Name: neuroblastoma, suppression of tumorigenicity 1 Calculated Molecular Weight: 180 aa, 19 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC012037 Gene Symbol: NBL1 Gene ID (NCBI): 4681 RRID: AB_10638604 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P41271 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924