Iright
BRAND / VENDOR: Proteintech

Proteintech, 12077-1-AP, TINAGL1 Polyclonal antibody

CATALOG NUMBER: 12077-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TINAGL1 (12077-1-AP) by Proteintech is a Polyclonal antibody targeting TINAGL1 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 12077-1-AP targets TINAGL1 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human placenta tissue, human adrenal gland tissue Positive IP detected in: mouse heart tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver cancer tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:300-1:1500 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Tubulointerstitial nephritis antigen-like 1 (Tinagl1), a secreted extracellular protein, was initially identified as a putative component of the ECM. Tinagl1 is most commonly associated with embryonic development, including the heart and adrenal glands. Low levels of Tinagl1 expression can be dire for craniofacial development and for female fertility. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2721 Product name: Recombinant human TINAGL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-218 aa of BC009048 Sequence: MTPVLSPQNLLSCDTHQQQGCRGGRLDGAWWFLRRRGVVSDHCYPFSGRERDEAGPAPPCMMHSRAMGRGKRQATAHCPNSYVNNNDIYQVTPVYRLGSNDKEIMKELMENGPVQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWGEETLPDGRTLKYWTAANSWGPAWGERGHFRIVRGVNECDIESFVLGVWGRVGMEDMGHH Predict reactive species Full Name: tubulointerstitial nephritis antigen-like 1 Calculated Molecular Weight: 467 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC009048 Gene Symbol: TINAGL1 Gene ID (NCBI): 64129 RRID: AB_2058942 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9GZM7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924