Iright
BRAND / VENDOR: Proteintech

Proteintech, 12086-1-AP, SLC25A10 Polyclonal antibody

CATALOG NUMBER: 12086-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC25A10 (12086-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A10 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12086-1-AP targets SLC25A10 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, A549 cells, mouse liver tissue, mouse kidney tissue, HepG2 cells, PC-3 cells Positive IP detected in: mouse liver tissue Positive IHC detected in: human lung tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SLC25A10, also known as dicarboxylate ion carrier (DIC), is a mitochondrial inner membrane carrier protein which catalyzes the transport of dicarboxylates such as malate and succinate across the mitochondrial membrane in exchange for phosphate, sulfate, and thiosulfate. SLC25A10 is expressed at highest levels in kidney and liver, lower levels in lung, spleen, heart, and brain, and lowest levels in skeletal muscle. Two isoforms of SLC25A10 exist due to the alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2719 Product name: Recombinant human SLC25A10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-296 aa of BC015797 Sequence: MAAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILALYSGLSASLCRQMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLSDNIFTHFVASFIAAAGDEPPPQGGCATFLCQPLDVLKTRLMNSKGEYQGVFHCAVETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKNFGIKVPS Predict reactive species Full Name: solute carrier family 25 (mitochondrial carrier; dicarboxylate transporter), member 10 Calculated Molecular Weight: 296 aa, 32 kDa Observed Molecular Weight: 29-31 kDa GenBank Accession Number: BC015797 Gene Symbol: SLC25A10 Gene ID (NCBI): 1468 RRID: AB_10859816 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBX3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924