Iright
BRAND / VENDOR: Proteintech

Proteintech, 12087-2-AP, TSPYL2/CDA1 Polyclonal antibody

CATALOG NUMBER: 12087-2-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TSPYL2/CDA1 (12087-2-AP) by Proteintech is a Polyclonal antibody targeting TSPYL2/CDA1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 12087-2-AP targets TSPYL2/CDA1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, DU 145 cells, HEK-293 cells, MCF-7 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Hela cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information TSPYL2 (also known as CINAP, CDA1, TSPX or DENTT) is a new member of the nucleosome assembly protein superfamily. TSPYL2 binds histones and facilitates nucleosome assembly. TSPYL2 is expressed in various tissues, highly in the pituitary gland and moderately in the adrenals, brain, testis, and ovary. Immunohistochemical staining analysis for TSPYL2 showed differential cytoplasmic and nuclear staining patterns in several cell types. Downregulated expression of TSPYL2 has been observed in several tumors, which suggests its role as a tumor suppressor. Although it is predicted that TSPYL2 has a molecular mass of 79.43 kDa, it is found that mammalian TSPYL2 appears at a size of 120 kDa by western blot analysis. The abundant acidic amino acid regions in TSPYL2 may cause its aberrant migration. In addition, the TSPYL2 protein is unstable and sensitive to proteasomal degradation. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2722 Product name: Recombinant human TSPYL2,TSPX,NP79 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 344-693 aa of BC024270 Sequence: WHRGQEPQARRHGNQDASHSFFSWFSNHSLPEADRIAEIIKNDLWVNPLRYYLRERGSRIKRKKQEMKKRKTRGRCEVVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTDYFETTDNEITDINENICDSENPDHNEVPNNETTDNNESADDHETTDNNESADDNNENPEDNNKNTDDNEENPNNNENTYGNNFFKGGFWGSHGNNQDSSDSDNEADEASDDEDNDGNEGDNEGSDDDGNEGDNEGSDDDDRDIEYYEKVIEDFDKDQADYEDVIEIISDESVEEEGIEEGIQQDEDIYEEGNYEEEGSEDVWEEGEDSDDSDLEDVLQVPNGWANPGKRGKTG Predict reactive species Full Name: TSPY-like 2 Calculated Molecular Weight: 693 aa, 79 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: BC024270 Gene Symbol: CDA1 Gene ID (NCBI): 64061 RRID: AB_2256811 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H2G4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924