Iright
BRAND / VENDOR: Proteintech

Proteintech, 12091-1-AP, G0S2 Polyclonal antibody

CATALOG NUMBER: 12091-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The G0S2 (12091-1-AP) by Proteintech is a Polyclonal antibody targeting G0S2 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 12091-1-AP targets G0S2 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: H9C2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information G0S2 is G0/G1 switch protein 2. It is an all trans- retinoic acid (RA) target gene. G0S2 promotes apoptosis by binding to BCL2, hence preventing the formation of protective BCL2-BAX heterodimers. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2731 Product name: Recombinant human G0S2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC009694 Sequence: METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHAS Predict reactive species Full Name: G0/G1switch 2 Calculated Molecular Weight: 11 kDa GenBank Accession Number: BC009694 Gene Symbol: G0S2 Gene ID (NCBI): 50486 RRID: AB_2877824 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P27469 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924