Proteintech, 12100-1-AP, FEZ1 Polyclonal antibody

Size: 20ul / 150ul The FEZ1 (12100-1-AP) by Proteintech is a Polyclonal antibody targeting FEZ1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 12100-1-AP targets FEZ1 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2744 Product name: Recombinant human FEZ1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 72-392 aa of BC009545 Sequence: VCFRNYNAKTENLAPVKNQLQIQEEEETLQDEEVWDALTDNYIPSLSEDWRDPNIEALNGNCSDTEIHEKEEEEFNEKSENDSGINEEPLLTADQVIEEIEEMMQNSPDPEEEEEVLEEEDGGETSSQADSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTELLDQVEGAIRDFSEELVQQLARRDELEFEKEVKNSFITVLIEVQNKQKEQRELMKKRRKEKGLSLQSSRIEKGNQMPLKRFSMEGISNILQSGIRQTFGSSGTDKQYLNTVIPYEKKASPPSVEDLQMLTNILFAMKEDNEKVPTLLTDYILKVLCPT Predict reactive species Full Name: fasciculation and elongation protein zeta 1 (zygin I) Calculated Molecular Weight: 392 aa, 45 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC009545 Gene Symbol: FEZ1 Gene ID (NCBI): 9638 RRID: AB_2877825 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99689 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.