Iright
BRAND / VENDOR: Proteintech

Proteintech, 12120-1-AP, SLC16A5 Polyclonal antibody

CATALOG NUMBER: 12120-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC16A5 (12120-1-AP) by Proteintech is a Polyclonal antibody targeting SLC16A5 in WB, IHC, ELISA applications with reactivity to human, mouse samples 12120-1-AP targets SLC16A5 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, human placenta tissue Positive IHC detected in: human breast cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Monocarboxylate transporter 5 (SLC16A5), also named as MCT6, is a member of the MCT family. SLC16A5 is a proton-linked monocarboxylate transporter that catalyzes the rapid transport across the plasma membrane of many monocarboxylates and it can transport various drugs. It has been reported that SLC16A5 mutation may be a novel genetic risk factor for cisplatin-induced ototoxic (CIO) in testicular cancer patients. There are some isoforms of SLC16A5 among 50-55 kDa. (PMID: 16174808, 28448657) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2762 Product name: Recombinant human SLC16A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 418-505 aa of BC009684 Sequence: ALQKKEQGKQAVAADALERDLFLEAKDGPGKQRSPEIMCQSSRQPRPAGVNKHLWGCPASSRTSHEWLLWPKAVLQAKQTALGWNSPT Predict reactive species Full Name: solute carrier family 16, member 5 (monocarboxylic acid transporter 6) Calculated Molecular Weight: 505 aa, 55 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC009684 Gene Symbol: SLC16A5 Gene ID (NCBI): 9121 RRID: AB_2877827 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15375 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924