Proteintech, 12122-1-AP, TSPAN5 Polyclonal antibody

Size: 20ul / 150ul The TSPAN5 (12122-1-AP) by Proteintech is a Polyclonal antibody targeting TSPAN5 in WB, IHC, ELISA applications with reactivity to human samples 12122-1-AP targets TSPAN5 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information TSPAN5 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. TSPAN5 belongs to the TSPANC8 subfamily, which also include TSPAN10, TSPAN14, TSPAN15, TSPAN17, and TSPAN33. It has been reported that TSPANC8 tetraspanins interact with ADAM10 and have a conserved function in the regulation of ADAM10 trafficking and activity, thereby positively regulating Notch receptor activation (PMID: 23091066; 23035126). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2765 Product name: Recombinant human TSPAN5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 117-240 aa of BC009704 Sequence: DWIKDQLYFFINNNIRAYRDDIDLQNLIDFTQEYWQCCGAFGADDWNLNIYFNCTDSNASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQFEKWLQDNLTIVAGIF Predict reactive species Full Name: tetraspanin 5 Calculated Molecular Weight: 268 aa, 30 kDa Observed Molecular Weight: 30-40 kDa, 90 kDa GenBank Accession Number: BC009704 Gene Symbol: TSPAN5 Gene ID (NCBI): 10098 RRID: AB_10638611 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62079 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.