Proteintech, 12126-2-AP, CHRAC1 Polyclonal antibody

Size: 20ul / 150ul The CHRAC1 (12126-2-AP) by Proteintech is a Polyclonal antibody targeting CHRAC1 in WB, IHC, ELISA applications with reactivity to human samples 12126-2-AP targets CHRAC1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, K-562 cells Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2770 Product name: Recombinant human CHRAC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-131 aa of BC015891 Sequence: MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS Predict reactive species Full Name: chromatin accessibility complex 1 Calculated Molecular Weight: 131 aa, 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC015891 Gene Symbol: CHRAC1 Gene ID (NCBI): 54108 RRID: AB_2291729 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRG0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.