Iright
BRAND / VENDOR: Proteintech

Proteintech, 12136-1-AP, NXT2 Polyclonal antibody

CATALOG NUMBER: 12136-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NXT2 (12136-1-AP) by Proteintech is a Polyclonal antibody targeting NXT2 in IHC, ELISA applications with reactivity to human, mouse, rat samples 12136-1-AP targets NXT2 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NXT2 is a member of NXT family proteins that are generally involved in exporting nuclear RNA in eukaryotic cells. The function of NXT2 has not been widely studied, and is yet to be fully elucidated. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2782 Product name: Recombinant human NXT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 37-197 aa of BC014888 Sequence: TREEVVTPTLPEHTATRSQMATSLDFKTYVDQACRAAEEFVNIYYETMDKRRRALTRLYLDKATLIWNGNAVSGLDALNNFFDTLPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHFFNQNFLLTAQSTPNNTVWKIASDCFRFQDWSSS Predict reactive species Full Name: nuclear transport factor 2-like export factor 2 Calculated Molecular Weight: 197 aa, 23 kDa GenBank Accession Number: BC014888 Gene Symbol: NXT2 Gene ID (NCBI): 55916 RRID: AB_2158284 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NPJ8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924