Proteintech, 12143-1-AP, p63 Polyclonal antibody

Size: 20ul / 150ul The p63 (12143-1-AP) by Proteintech is a Polyclonal antibody targeting p63 in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 12143-1-AP targets p63 in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, human heart tissue, mouse heart tissue, U-937 cells, Apoptosised HeLa cells, HaCaT cells, PC-12 cells, mouse thymus tissue Positive IP detected in: A431 cells Positive IHC detected in: human lung cancer tissue, human bowen disease tissue, human prostate cancer tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human lung cancer tissue Positive IF/ICC detected in: A431 cells Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information TP63, also named KET, P63, P73H, P73L and TP73L, belongs to the p53 family. It is a homologue of the tumor suppressor p53 and p73 genes. It is involved in malignancy acquisition and maintenance of cells. Unlike p53, the p63 gene encodes multiple isotypes with remarkably divergent abilities to transactivate p53 reporter genes and induce apoptosis. TP63 acts as a sequence specific DNA binding transcriptional activator or repressor. TP63 has 12 isoforms with MW 40kd(P40), 50kd(P60),63kd(P63) and 73kd(P73L). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2791 Product name: Recombinant human TP63 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 381-680 aa of BC039815 Sequence: NTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSPSSYGNSSPPLNKMNSMNKLPSVSQLINPQQRNALTPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWNDFNFDMDARRNKQQRIKEEGE Predict reactive species Full Name: tumor protein p63 Calculated Molecular Weight: 680 aa, 77 kDa Observed Molecular Weight: 63-68 kDa GenBank Accession Number: BC039815 Gene Symbol: TP63 Gene ID (NCBI): 8626 RRID: AB_10597397 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H3D4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.