Iright
BRAND / VENDOR: Proteintech

Proteintech, 12154-1-AP, LMBR1L Polyclonal antibody

CATALOG NUMBER: 12154-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LMBR1L (12154-1-AP) by Proteintech is a Polyclonal antibody targeting LMBR1L in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 12154-1-AP targets LMBR1L in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, A549 cells, HepG2 cells, mouse liver tissue, rat testis tissue Positive IP detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information LMBR1L, also known as LIMR (lipocalin-1-interacting membrane receptor), interacts with lipocalin-1 (Lcn-1), a lipocalin member produced by a number of secretoric glands and tissues and known to bind a variety of lipophilic compounds. LMBR1L is a 489-amino acid protein with a predicted molecular mass of 55 kD and 9 putative transmembrane helices. LMBR1L has been shown to mediate cellular uptake of LMBR1L, thus it is characterized as a endocytic receptor (PMID: 11287427; 12591932). Alternatively spliced transcript variants encoding different isoforms have been described. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2787 Product name: Recombinant human LMBR1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 219-490 aa of BC015015 Sequence: RMFSVTGKLLVKPRLLEDLEEQLYCSAFEEAALTRRICNPTSCWLPLDMELLHRQVLALQTQRVLLEKRRKASAWQRNLGYPLAMLCLLVLTGLSVLIVAIHILELLIDEAAMPRGMQGTSLGQVSFSKLGSFGAVIQVVLIFYLMVSSVVGFYSSPLFRSLRPRWHDTAMTQIIGNCVCLLVLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAAFAGLTTLCLVKTFTAAVRAELIRAFGLDRLPLPVSGFPQASRKTQHQ Predict reactive species Full Name: limb region 1 homolog (mouse)-like Calculated Molecular Weight: 489 aa, 55 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC015015 Gene Symbol: LMBR1L Gene ID (NCBI): 55716 RRID: AB_2136130 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UX01 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924