Iright
BRAND / VENDOR: Proteintech

Proteintech, 12166-1-AP, Dysadherin Polyclonal antibody

CATALOG NUMBER: 12166-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Dysadherin (12166-1-AP) by Proteintech is a Polyclonal antibody targeting Dysadherin in WB, IHC, ELISA applications with reactivity to human, mouse samples 12166-1-AP targets Dysadherin in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse small intestine tissue, human placenta tissue Positive IHC detected in: human kidney tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Dysadherin, also known as FXYD5 (FXYD domain containing ion transport regulator 5), is a cancer-associated cell membrane glycoprotein which belongs to the FXYD family. The FXYD family, which contains seven members, are tissue specific regulators of the Na,K-ATPase. Dysadherin is involved in down-regulation of E-cadherin, which plays important roles in tumor development and metastasis. It is present in spleen, lung, skeletal muscle, and testis. Increased expression of dysadherin has been associated with increased cell motility and metastatic potential. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2808 Product name: Recombinant human FXYD5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-178 aa of BC009642 Sequence: KDTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKRGLLVAAVLFITGIIILTSGKCRQLSRLCRNHCR Predict reactive species Full Name: FXYD domain containing ion transport regulator 5 Calculated Molecular Weight: 178 aa, 19 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC009642 Gene Symbol: Dysadherin Gene ID (NCBI): 53827 RRID: AB_10640583 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96DB9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924