Iright
BRAND / VENDOR: Proteintech

Proteintech, 12167-1-AP, SMAD5 Polyclonal antibody

CATALOG NUMBER: 12167-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SMAD5 (12167-1-AP) by Proteintech is a Polyclonal antibody targeting SMAD5 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12167-1-AP targets SMAD5 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, NIH/3T3 cells, PC-12 cells Positive IP detected in: HeLa cells Positive IF/ICC detected in: HeLa cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SMAD5, also named as MADH5 and JV5-1, is a transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase. SMAD5 is a receptor-regulated SMAD (R-SMAD). It plays a critical role in the signaling pathway by which TGF-beta inhibits the proliferation of human hematopoietic progenitor cells. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2809 Product name: Recombinant human SMAD5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 161-465 aa of BC009682 Sequence: SHNEPHMPQNATFPDSFHQPNNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS Predict reactive species Full Name: SMAD family member 5 Calculated Molecular Weight: 465 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC009682 Gene Symbol: SMAD5 Gene ID (NCBI): 4090 RRID: AB_2286502 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99717 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924