Proteintech, 12178-1-AP, SMNDC1 Polyclonal antibody

Size: 20ul / 150ul The SMNDC1 (12178-1-AP) by Proteintech is a Polyclonal antibody targeting SMNDC1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12178-1-AP targets SMNDC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, human heart tissue, human lung tissue, human liver tissue, mouse skeletal muscle tissue, rat heart tissue Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Survival motor neuron domain-containing protein 1 (SMNDC1), also known as survival of motor neuron-related-splicing factor 30 (SPF30) or SMN-related protein (SMNR), is a constituent of the spliceosome complex that plays an essential role in spliceosome assembly by recruiting U4/U5/U6 tri-snRNP to the pre-spliceosomal complex (PMID: 9817934; 11331595; 30904945). Both SMNDC1 and SMN1 contain a highly conserved central Tudor domain which functions as a protein-protein interaction surface and mediates binding to the spliceosomal Sm proteins (PMID: 11331595). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2822 Product name: Recombinant human SMNDC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-238 aa of BC011234 Sequence: MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ Predict reactive species Full Name: survival motor neuron domain containing 1 Calculated Molecular Weight: 238 aa, 27 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC011234 Gene Symbol: SMNDC1 Gene ID (NCBI): 10285 RRID: AB_2239665 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75940 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.