Iright
BRAND / VENDOR: Proteintech

Proteintech, 12194-1-AP, SPSB1 Polyclonal antibody

CATALOG NUMBER: 12194-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SPSB1 (12194-1-AP) by Proteintech is a Polyclonal antibody targeting SPSB1 in WB, ELISA applications with reactivity to human, mouse samples 12194-1-AP targets SPSB1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, Calu-1 cells, K-562 cells, L02 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information SPSB1, also known as Single-stranded DNA binding protein 1 (SSB1), is a member of the single-stranded DNA binding protein (SSB) family. It plays a pivotal role in the DNA damage response. As an early responder, SSB1 promptly associates with exposed single-strand DNA to shield it from degradation by various nucleases present in the cellular milieu. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2832 Product name: Recombinant human SPSB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-273 aa of BC015711 Sequence: MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGRERLGEIHTLPLPASLKAYLLYQ Predict reactive species Full Name: splA/ryanodine receptor domain and SOCS box containing 1 Calculated Molecular Weight: 273 aa, 31 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC015711 Gene Symbol: SPSB1 Gene ID (NCBI): 80176 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96BD6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924