Proteintech, 12207-1-AP, PCTAIRE3 Polyclonal antibody

Size: 20ul / 150ul The PCTAIRE3 (12207-1-AP) by Proteintech is a Polyclonal antibody targeting PCTAIRE3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 12207-1-AP targets PCTAIRE3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse brain tissue Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PCTAIRE3 (PCTAIRE-motif protein kinase 3), also named CDK18 or PCTK3, is a member of PCTAIRE subfamily. The PCTAIRE kinase (PCTK) subfamily of CDKs includes three members, PCTK1/CDK16, PCTK2/CDK17, and PCTK3/CDK18, which contain the PCTAIRE sequence instead of the PSTAIRE sequence (PMID: 24831015). PCTK3 has three isoforms with the molecular mass of 54-58kD. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2851 Product name: Recombinant human PCTK3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 144-472 aa of BC011526 Sequence: KLDKLGEGTYATVFKGRSKLMENLVALKEIRLEHEEGAPCTAIREVSLLKNLKHANIVTLHDLIHTDRSLTLVFEYLDSDLKQYLDHCGNLMSMHNVKIFMFQLLRGLAYCHHRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMATGRPLFPGSTVKEELHLIFRLLGTPTEETWPGVTAFSEFRTYSFPCYLPQPLINHAPRLDTDGIHLLSSLLLYESKSRMSAEAALSHSYFRSLGERVHQLEDTASIFSLKEIQLQKDPGYRGLAFQQPGRGKNRRQSIF Predict reactive species Full Name: PCTAIRE protein kinase 3 Calculated Molecular Weight: 472 aa, 54 kDa Observed Molecular Weight: 54 kDa, 58 kDa GenBank Accession Number: BC011526 Gene Symbol: PCTAIRE3 Gene ID (NCBI): 5129 RRID: AB_906375 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q07002 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.