Product Description
Size: 20ul / 150ul
The SH3BGRL3 (12210-1-AP) by Proteintech is a Polyclonal antibody targeting SH3BGRL3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
12210-1-AP targets SH3BGRL3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: PC-3 cells, U-251 cells
Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:400-1:1600
Background Information
SH3BGRL3, SH3 domain-binding glutamic acid-rich-like protein, could act as a modulator of glutaredoxin biological activity. It may play a role in cytoskeleton organization (PMID: 34380438). SH3BGRL3 acts as a potential prognostic biomarker for urothelial carcinoma and a novel binding partner of epidermal growth factor receptor (PMID: 26286913).
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag2857 Product name: Recombinant human SH3BGRL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-93 aa of BC030135 Sequence: MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLA Predict reactive species
Full Name: SH3 domain binding glutamic acid-rich protein like 3
Calculated Molecular Weight: 93 aa, 10 kDa
Observed Molecular Weight: 10 kDa
GenBank Accession Number: BC030135
Gene Symbol: SH3BGRL3
Gene ID (NCBI): 83442
RRID: AB_10694666
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9H299
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924