Iright
BRAND / VENDOR: Proteintech

Proteintech, 12210-1-AP, SH3BGRL3 Polyclonal antibody

CATALOG NUMBER: 12210-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SH3BGRL3 (12210-1-AP) by Proteintech is a Polyclonal antibody targeting SH3BGRL3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12210-1-AP targets SH3BGRL3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, U-251 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information SH3BGRL3, SH3 domain-binding glutamic acid-rich-like protein, could act as a modulator of glutaredoxin biological activity. It may play a role in cytoskeleton organization (PMID: 34380438). SH3BGRL3 acts as a potential prognostic biomarker for urothelial carcinoma and a novel binding partner of epidermal growth factor receptor (PMID: 26286913). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2857 Product name: Recombinant human SH3BGRL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-93 aa of BC030135 Sequence: MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLA Predict reactive species Full Name: SH3 domain binding glutamic acid-rich protein like 3 Calculated Molecular Weight: 93 aa, 10 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC030135 Gene Symbol: SH3BGRL3 Gene ID (NCBI): 83442 RRID: AB_10694666 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H299 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924