Iright
BRAND / VENDOR: Proteintech

Proteintech, 12222-1-AP, DPEP1 Polyclonal antibody

CATALOG NUMBER: 12222-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DPEP1 (12222-1-AP) by Proteintech is a Polyclonal antibody targeting DPEP1 in WB, ELISA applications with reactivity to human, mouse, rat samples 12222-1-AP targets DPEP1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, mouse liver tissue, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information DPEP1(Dipeptidase 1) is also named as MDP, RDP and belongs to the peptidase M19 family. It is a glycoprotein that plays an important role in the regulation of leukotriene activity. DPEP1 converts lekotriene D4 to leukotriene E4. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2907 Product name: Recombinant human DPEP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-385 aa of BC017023 Sequence: MWSGWWLWPLVAVCTADFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS Predict reactive species Full Name: dipeptidase 1 (renal) Calculated Molecular Weight: 411 aa, 46 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC017023 Gene Symbol: DPEP1 Gene ID (NCBI): 1800 RRID: AB_2877837 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P16444 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924