Proteintech, 12224-1-AP, DAK Polyclonal antibody

Size: 20ul / 150ul The DAK (12224-1-AP) by Proteintech is a Polyclonal antibody targeting DAK in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 12224-1-AP targets DAK in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, mouse uterus tissue, HepG2 cells Positive IP detected in: HeLa cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information DAK, also name as TKFC, Triokinase, and FMN cyclase, catalyzes both the phosphorylation of dihydroxyacetone and of glyceraldehyde, and the splitting of ribonucleoside diphosphate-X compounds among which FAD is the best substrate. DAK has some isoforms with MW 51-55 kDa and 59 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2861 Product name: Recombinant human DAK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 226-576 aa of BC001341 Sequence: VRRIKMATADEIVKLMLDHMTNTTNASHVPVQPGSSVVMMVNNLGGLSFLELGIIADATVRSLEGRGVKIARALVGTFMSALEMPGISLTLLLVDEPLLKLIDAETTAAAWPNVAAVSITGRKRSRVAPAEPQEAPDSTAAGGSASKRMALVLERVCSTLLGLEEHLNALDRAAGDGDCGTTHSRAARAIQEWLKEGPPPASPAQLLSKLSVLLLEKMGGSSGALYGLFLTAAAQPLKAKTSLPAWSAAMDAGLEAMQKYGKAAPGDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAVKSAEAAAEATKNMEAGAGRASYISSARLEQPDPGAVAAAAILRAILEVLQS Predict reactive species Full Name: dihydroxyacetone kinase 2 homolog (S. cerevisiae) Calculated Molecular Weight: 575 aa, 59 kDa Observed Molecular Weight: 55-59 kDa GenBank Accession Number: BC001341 Gene Symbol: DAK Gene ID (NCBI): 26007 RRID: AB_2277108 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q3LXA3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.