Proteintech, 12247-1-AP, CHURC1 Polyclonal antibody

Size: 20ul / 150ul The CHURC1 (12247-1-AP) by Proteintech is a Polyclonal antibody targeting CHURC1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12247-1-AP targets CHURC1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skin tissue, HeLa cells, mouse liver tissue Positive IHC detected in: human brain tissue, human gliomas tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information CHURC1 (churchill domain containing 1), also known as C14orf52 or chch. The function of CHURC1 has not been widely studied, and is yet to be fully elucidated. It may be a transcriptional activator that mediates FGF signaling during neural development.The MW of this protein is 13 kDa, and Catalog#12247-1-AP specially recognises the 13 kDa protein. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2892 Product name: Recombinant human CHURC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC020550 Sequence: MCGDCVEKEYPNRGNTCLENGSFLLNFTGCAVCSKRDFMLITNKSLKEEDGEEIVTYDHLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDPRQMTLLF Predict reactive species Full Name: churchill domain containing 1 Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC020550 Gene Symbol: CHURC1 Gene ID (NCBI): 91612 RRID: AB_10666204 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WUH1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.