Proteintech, 12260-1-AP, SULF2 Polyclonal antibody

Size: 20ul / 150ul The SULF2 (12260-1-AP) by Proteintech is a Polyclonal antibody targeting SULF2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12260-1-AP targets SULF2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue Positive IHC detected in: human breast cancer tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information SULF2, also named as KIAA1247, belongs to the sulfatase family. It exhibits arylsulfatase activity and highly specific endoglucosamine-6-sulfatase activity. SULF2 can remove sulfate from the C-6 position of glucosamine within specific subregions of intact heparin. SULF2 has several forms: the unglycosylated 100 kDa SULF2, the glycosylated 120-150 kDa SULF2, the cleaved 72-75 kDa and 50 kDa SULF2. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2915 Product name: Recombinant human SULF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 722-870 aa of BC020962 Sequence: MPGLTCFTHDNQHWQTAPFWTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYEQYRQFQRRKWPEMKRPSSKSLGQLWEGWEG Predict reactive species Full Name: sulfatase 2 Calculated Molecular Weight: 870 aa, 96 kDa Observed Molecular Weight: 50 kDa, 130-150 kDa GenBank Accession Number: BC020962 Gene Symbol: SULF2 Gene ID (NCBI): 55959 RRID: AB_11183762 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IWU5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.