Iright
BRAND / VENDOR: Proteintech

Proteintech, 12268-1-AP, REG4 Polyclonal antibody

CATALOG NUMBER: 12268-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The REG4 (12268-1-AP) by Proteintech is a Polyclonal antibody targeting REG4 in WB, IHC, ELISA applications with reactivity to human, mouse samples 12268-1-AP targets REG4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, SGC-7901 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information REG4 (Regenerating islet-derived protein 4) is a secreted C-type lectin that belongs to the regenerating gene (REG) family. Initially identified in a cDNA library from ulcerative colitis tissue, REG4 is predominantly expressed by intestinal enteroendocrine cells and is markedly up-regulated during gut inflammation and in various gastrointestinal cancers. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2934 Product name: Recombinant human REG4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-158 aa of BC017089 Sequence: VLGDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP Predict reactive species Full Name: regenerating islet-derived family, member 4 Calculated Molecular Weight: 158 aa, 18 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC017089 Gene Symbol: REG4 Gene ID (NCBI): 83998 RRID: AB_2178702 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BYZ8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924