Proteintech, 12289-1-AP, Clusterin Polyclonal antibody

Size: 20ul / 150ul The Clusterin (12289-1-AP) by Proteintech is a Polyclonal antibody targeting Clusterin in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human samples 12289-1-AP targets Clusterin in WB, IHC, IF/ICC, IF-P, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma Positive IHC detected in: human tonsillitis tissue, human breast cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver tissue, HeLa cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Clusterin (Apolipoprotein J) is a 75-80 kDa heterodimeric glycoprotein produced by a wide array of tissues and found in most biologic fluids (PMID: 7648419; 11906815). It is encoded by one single gene and cleaved posttranslationally into α (34-36 kDa) and β (36-39 kDa) subunits prior to secretion from the cell. Many functions have been described for clusterin, including regulating apoptosis, transporting lipids, controlling cell interactions, regulating complement (PMID: 10694874). Specification Tested Reactivity: human Cited Reactivity: human, rabbit Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2889 Product name: Recombinant human CLU protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 101-449 aa of BC010514 Sequence: VCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE Predict reactive species Full Name: clusterin Calculated Molecular Weight: 449 aa, 53 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC010514 Gene Symbol: CLU Gene ID (NCBI): 1191 RRID: AB_2083316 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10909 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.