Iright
BRAND / VENDOR: Proteintech

Proteintech, 12290-1-AP, RHOF Polyclonal antibody

CATALOG NUMBER: 12290-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RHOF (12290-1-AP) by Proteintech is a Polyclonal antibody targeting RHOF in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 12290-1-AP targets RHOF in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, human brain tissue, COLO 320 cells, mouse brain tissue, rat brain tissue Positive IP detected in: COLO 320 cells Positive IHC detected in: human colon cancer tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2943 Product name: Recombinant human RHOF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC018208 Sequence: MDAPGALAQTAAPGPGRKELKIVIVGDGGCGKTSLLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYMQVGRGQDPGAQPWL Predict reactive species Full Name: ras homolog gene family, member F (in filopodia) Calculated Molecular Weight: 211 aa, 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC018208 Gene Symbol: RHOF Gene ID (NCBI): 54509 RRID: AB_10644126 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HBH0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924