Iright
BRAND / VENDOR: Proteintech

Proteintech, 12294-1-AP, GATAD2A Polyclonal antibody

CATALOG NUMBER: 12294-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GATAD2A (12294-1-AP) by Proteintech is a Polyclonal antibody targeting GATAD2A in WB, ELISA applications with reactivity to human samples 12294-1-AP targets GATAD2A in WB, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2947 Product name: Recombinant human GATAD2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 369-634 aa of BC012902 Sequence: PAPEMNFLPSAANNEFIYLVGLEEVVQNLLETQAGRMSAATVLSREPYMCAQCKTDFTCRWREEKSGAIMCENCMTTNQKKALKVEHTSRLKAAFVKALQQEQEIEQRLLQQGTAPAQAKAEPTAAPHPVLKQVIKPRRKLAFRSGEARDWSNGAVLQASSQLSRGSATTPRGVLHTFSPSPKLQNSASATALVSRTGRHSERTVSAGKGSATSNWKKTPLSTGGTLAFVSPSLAVHKSSSAVDRQREYLLDMIPPRSIPQSATWK Predict reactive species Full Name: GATA zinc finger domain containing 2A Calculated Molecular Weight: 633 aa, 68 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC012902 Gene Symbol: GATAD2A Gene ID (NCBI): 54815 RRID: AB_2877843 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86YP4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924