Proteintech, 12295-1-AP, Prohibitin 2 Polyclonal antibody

Size: 20ul / 150ul The Prohibitin 2 (12295-1-AP) by Proteintech is a Polyclonal antibody targeting Prohibitin 2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples 12295-1-AP targets Prohibitin 2 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA, Electrochemical Immunosensor applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells Positive IP detected in: HeLa cells, mouse brain tissue Positive IHC detected in: human heart tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information PHB2, also named as BAP, REA, D-prohibitin, BAP37 and Prohibitin-2, belongs to the prohibitin family. It acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases. PHB2 functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. It competes with NCOA1 for modulation of ER transcriptional activity. PHB2 is probably involved in regulating mitochondrial respiration activity and in aging.(PMID: 10359819) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, rice Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2977 Product name: Recombinant human PHB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-299 aa of BC014766 Sequence: MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK Predict reactive species Full Name: prohibitin 2 Calculated Molecular Weight: 299 aa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC014766 Gene Symbol: Prohibitin 2 Gene ID (NCBI): 11331 RRID: AB_2164779 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99623 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.