Iright
BRAND / VENDOR: Proteintech

Proteintech, 12296-1-AP, SFXN1 Polyclonal antibody

CATALOG NUMBER: 12296-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SFXN1 (12296-1-AP) by Proteintech is a Polyclonal antibody targeting SFXN1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 12296-1-AP targets SFXN1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, human brain tissue, mouse liver tissue, mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human breast cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SFXN1, the founding member of the SLC56 family, was identified by positional cloning of the mutation in the flexed-tail mouse model with sideroblastic anemia. SFXN1 was recently identified as a mitochondrial serine transporter essential for one-carbon (1C) metabolism, a process in which folate species are generated and used in biosynthetic pathways required for cell proliferation. In HEK293 cells, SFXN1 is the most abundant isoform among the SFXNs. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2985 Product name: Recombinant human SFXN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-236 aa of BC020517 Sequence: MILIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLNALTKHVSPLIGRFVPFAAVAAANCINIPLMRQRELKVGIPVTDENGNRLGESANAAKQAITQVVVSRILMAAPGMAIPPFIMNTLEKKAFLKRFPWMSAPIQVGLVGFCLVFATPLCCALFPQKSSMSVTSLEAELQAKIQESHPELRRVYFNKGL Predict reactive species Full Name: sideroflexin 1 Calculated Molecular Weight: 35.6 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC020517 Gene Symbol: SFXN1 Gene ID (NCBI): 94081 RRID: AB_2185814 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H9B4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924