Proteintech, 12300-1-AP, ITGB1BP1 Polyclonal antibody

Size: 20ul / 150ul The ITGB1BP1 (12300-1-AP) by Proteintech is a Polyclonal antibody targeting ITGB1BP1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12300-1-AP targets ITGB1BP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, mouse thymus tissue, human brain tissue Positive IP detected in: mouse thymus tissue Positive IHC detected in: human heart tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ITGB1BP1, also named as ICAP1, is a key regulator of the integrin-mediated cell-matrix interaction signaling by binding to the ITGB1 cytoplasmic tail. It plays a role in cell proliferation, differentiation, spreading, adhesion and migration in the context of mineralization and bone development and angiogenesis. ITGB1BP1 promotes transcriptional activity of the MYC promoter. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2945 Product name: Recombinant human ITGB1BP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 8-200 aa of BC012264 Sequence: RHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGVGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP Predict reactive species Full Name: integrin beta 1 binding protein 1 Calculated Molecular Weight: 200 aa, 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC012264 Gene Symbol: ITGB1BP1 Gene ID (NCBI): 9270 RRID: AB_10640896 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14713 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.