Proteintech, 12303-1-AP, PDCD6/ALG2 Polyclonal antibody

Size: 20ul / 150ul The PDCD6/ALG2 (12303-1-AP) by Proteintech is a Polyclonal antibody targeting PDCD6/ALG2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12303-1-AP targets PDCD6/ALG2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells, HeLa cells, HepG2 cells, K-562 cells, NIH/3T3 cells, mouse liver tissue, rat liver tissue Positive IP detected in: HeLa cells Positive IHC detected in: human lung cancer tissue, human liver cancer tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MDCK cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Programmed cell death protein 6 (PDCD6) is also named as ALG2. PDCD6 is an evolutionarily conserved Ca2+-binding protein. PDCD6 is required for coat protein complex II-dependent endoplasmic reticulum-to-Golgi apparatus vesicular transport in the cytoplasm (PMID: 39934130). PDCD6 is involved in regulating multifaceted and pleiotropic cellular processes in different cellular compartments. The nuclear PDCD6 regulates apoptosis and alternative splicing. And cytoplasmic PDCD6 is involved in the regulation of cytoskeletal dynamics and innate immune responses. Additionally, membranous PDCD6 participates in membrane repair through endosomal sorting complex required for transport complex-dependent membrane budding. (PMID: 38436472). PDCD6 also acts as a regulator of cytosolic DNA-induced immune responses by modulating STING transport (PMID: 34787301). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2949 Product name: Recombinant human PDCD6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-191 aa of BC012384 Sequence: MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV Predict reactive species Full Name: programmed cell death 6 Calculated Molecular Weight: 191 aa, 22 kDa Observed Molecular Weight: 15-22 kDa GenBank Accession Number: BC012384 Gene Symbol: PDCD6 Gene ID (NCBI): 10016 RRID: AB_2162459 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75340 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.