Proteintech, 12307-2-AP, GEMIN6 Polyclonal antibody

Size: 20ul / 150ul The GEMIN6 (12307-2-AP) by Proteintech is a Polyclonal antibody targeting GEMIN6 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 12307-2-AP targets GEMIN6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information GEMIN6, also named as SIP2, is a subunit of SMN complex. It plays an important role in the splicing of cellular pre-mRNAs. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2954 Product name: Recombinant human GEMIN6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-167 aa of BC018195 Sequence: MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYDPENCSSSNEIILSRVQDLIEGHLTASQ Predict reactive species Full Name: gem (nuclear organelle) associated protein 6 Calculated Molecular Weight: 167 aa, 19 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC018195 Gene Symbol: GEMIN6 Gene ID (NCBI): 79833 RRID: AB_2111835 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WXD5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.